DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5001 and DnaJ-60

DIOPT Version :9

Sequence 1:	NP_001245832.1	Gene:	CG5001 / 33308	FlyBaseID:	FBgn0031322	Length:	350	Species:	Drosophila melanogaster
Sequence 2:	NP_523840.1	Gene:	DnaJ-60 / 37869	FlyBaseID:	FBgn0260775	Length:	217	Species:	Drosophila melanogaster

Alignment Length:	64	Identity:	21/64 - (32%)
Similarity:	38/64 - (59%)	Gaps:	3/64 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPD-KNKAANAE--DKFKEVAEAYEVLSDKSKREVYD 65
            :|::|.:....:..|::.|:.:|:..|||| |:.||..|  .:|.:::|||:.|....:|..||
  Fly    27 HYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRRDYD 90

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5001	NP_001245832.1	DnaJ	1..347	CDD:223560	21/64 (33%)
		DnaJ	4..65	CDD:278647	19/62 (31%)
		DnaJ_C	174..338	CDD:199909
DnaJ-60	NP_523840.1	DnaJ	26..90	CDD:278647	19/62 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910