DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb1

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:355 Identity:178/355 - (50%)
Similarity:243/355 - (68%) Gaps:22/355 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||||||:.|||.:.|:|||||:|||:.||||||||||...||:||||:||||:||||..|||::|
  Rat     1 MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFD 65

  Fly    66 KYGEDGLKSGGT---RNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDL 127
            :|||:|||.||.   .:||.:..||:|.|||||.|.||:|||..|||.:||...:.   ::..|:
  Rat    66 RYGEEGLKGGGPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNG---EEGMDI 127

  Fly   128 DTEPDFFSSPFGGIGSRHGLGSG-FRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGC 191
            |   |.|||...|:|....:..| .||:        ..|.:|  ||||||.|||.|:|||||.||
  Rat   128 D---DPFSSFPMGMGGFTNMNFGRSRPT--------QEPTRK--KQDPPVTHDLRVSLEEIYSGC 179

  Fly   192 VKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPH 255
            .||||||.:.:..||.| |.|:|.|.|.:|.|||.|||:||.|||||....|||||||:::||||
  Rat   180 TKKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPH 244

  Fly   256 AMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDT 320
            .:|||:|||:.|.||::|::||||....|||:.|..:.: ..:::|:|...:::.|.|||.||..
  Rat   245 NIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPV-VFKDVIRPGMRRKVPGEGLPLPKTP 308

  Fly   321 TRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            .::|||::.|::.||:::..:.:.:|:.:|
  Rat   309 EKRGDLVIEFEVIFPDRIPISSRTILEQVL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 176/350 (50%)
DnaJ 4..65 CDD:278647 42/60 (70%)
DnaJ_C 174..338 CDD:199909 85/164 (52%)
Dnajb1NP_001382078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347668
Domainoid 1 1.000 103 1.000 Domainoid score I6631
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2057
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100302
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X227
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.