DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnaja3

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001033684.2 Gene:Dnaja3 / 360481 RGDID:1306527 Length:480 Species:Rattus norvegicus


Alignment Length:391 Identity:106/391 - (27%)
Similarity:166/391 - (42%) Gaps:107/391 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKNK-AANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            |||:|||:|:.|:..:|||||.:||.:||||.|| ...|::||.::|||||||||:.||:.||.|
  Rat    93 DYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAY 157

  Fly    68 GEDGLKSG------GTRNGGPSSNSFTYQFHGDPRATFAQFFG--NSNPFASFFDMGDNLFDKK- 123
            |..|...|      |...||||.         ||...|.:.||  :|:||..|    .|:||:. 
  Rat   158 GSAGFDPGASSSGQGYWRGGPSV---------DPEELFRKIFGEFSSSPFGDF----QNVFDQPQ 209

  Fly   124 --VFDLDTEPDFFSSPFGGIGSRHGL----------GSGFRPSFRSHSFNVHTPFKKEQKQDPPV 176
              :.:|.     |:....|:.....:          |.|..|..:                   |
  Rat   210 EYIMELT-----FNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTK-------------------V 250

  Fly   177 EHDLYVT---LEEIYHGCVKKMKISRR------------IVQADGSSRKEEKFLAISIKPGWKSG 226
            :|..|.:   :|.|..|........||            :|.......|::|.:.:.:..|.:.|
  Rat   251 QHCHYCSGSGMETINTGPFVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTVPVPAGVEDG 315

  Fly   227 TKVTFQKEGDQAP-GKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCG---------VV 281
            ..|       :.| ||....:.|.::..|  :|:|:|:|:.....:::.||:.|         ..
  Rat   316 QTV-------RMPVGKREIFVTFRVQKSP--VFRRDGADIHSDLFISIAQAILGGTAKAQGLYET 371

  Fly   282 FQVPTMSGDKLRISTMQEI-IKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEV 345
            ..|...:|    |.|.|:| :....:.||..||.         ||..:...|:.|::|::.|:.:
  Rat   372 INVTIPAG----IQTDQKIRLTGKGIPRINSYGY---------GDHYIHIKIRVPKRLSSRQQNL 423

  Fly   346 L 346
            :
  Rat   424 I 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 106/391 (27%)
DnaJ 4..65 CDD:278647 35/61 (57%)
DnaJ_C 174..338 CDD:199909 40/189 (21%)
Dnaja3NP_001033684.2 DnaJ 90..480 CDD:223560 106/391 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.