DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJB2

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens


Alignment Length:289 Identity:99/289 - (34%)
Similarity:129/289 - (44%) Gaps:94/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            ||:||.:|::|:.|:||||||:.||::|||||  ....||.|||||||||||||||.|||:||:|
Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68

  Fly    68 GEDGLKSGGT-------RNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVF 125
            |.:||...||       .:|||   .||:.|. .|...|.:|||:.:|||..||           
Human    69 GREGLTGTGTGPSRAEAGSGGP---GFTFTFR-SPEEVFREFFGSGDPFAELFD----------- 118

  Fly   126 DLDTEPDFFSSPFGGI---GSRHGLGSG----FRPSFRSH------------------SFNVHTP 165
            ||        .||..:   ||||   ||    |..||..|                  |.:..|.
Human   119 DL--------GPFSELQNRGSRH---SGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTT 172

  Fly   166 FKKEQK-----------QDPPVEHD---LYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLA 216
            |.:.::           :...||.|   ..||:..:.......:::|||..|...:||       
Human   173 FVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSR------- 230

  Fly   217 ISIKPGWKSGTKVTFQKEGDQAPGKIPAD 245
                   ..||:|      .|.|...|.|
Human   231 -------SGGTQV------QQTPASCPLD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 99/289 (34%)
DnaJ 4..65 CDD:278647 40/61 (66%)
DnaJ_C 174..338 CDD:199909 18/75 (24%)
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 59/109 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..90 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..324 13/49 (27%)
CAAX motif. /evidence=ECO:0000269|PubMed:12754272 321..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.