DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnaja4

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:396 Identity:114/396 - (28%)
Similarity:166/396 - (41%) Gaps:133/396 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGE 69
            ||.|||:..:|:.:|||||||||||:||||||  .:..:|||.:::|||||||..||::||:.||
  Rat   165 YYDILGVKPSASPEEIKKAYRKLALKYHPDKN--PDEGEKFKLISQAYEVLSDPKKRDIYDQGGE 227

  Fly    70 DGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFF 134
            ..:|.||  :|.||.:|        |...|..|||.                             
  Rat   228 QAIKEGG--SGSPSFSS--------PMDIFDMFFGG----------------------------- 253

  Fly   135 SSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISR 199
                ||..:|...|..                         |.|.|.||||::|:|..||:.:.:
  Rat   254 ----GGRMTRERRGKN-------------------------VVHQLSVTLEDLYNGITKKLALQK 289

  Fly   200 RIV--QADGSSRK---------------------------------------------------- 210
            .|:  :.:|...|                                                    
  Rat   290 NIICEKCEGIGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCED 354

  Fly   211 --------EEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRY 267
                    |:|.:.:.:..|.|.|.|:.|..||||.|...|.|::.::..|.|::|:|.|.||..
  Rat   355 CSGAKVTREKKIIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIM 419

  Fly   268 TARLTLKQALCGVVFQVPTMSGDKLRISTMQ-EIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFD 331
            ..::.|.:||||....:.|:....|.||:.. |:||...:|.::..|:|..|....||.|::.|.
  Rat   420 KMKIQLSEALCGFKKTIKTLDDRVLIISSKSGEVIKHGDLKCVRNEGMPIYKAPLEKGMLIIQFL 484

  Fly   332 IQFPEK 337
            :.||||
  Rat   485 VVFPEK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 114/396 (29%)
DnaJ 4..65 CDD:278647 35/59 (59%)
DnaJ_C 174..338 CDD:199909 59/227 (26%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 114/396 (29%)
DnaJ 165..223 CDD:278647 35/59 (59%)
DnaJ_C 264..490 CDD:199909 57/250 (23%)
DnaJ_zf 293..359 CDD:199908 2/65 (3%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.