DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb12

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001013929.1 Gene:Dnajb12 / 294513 RGDID:1359677 Length:378 Species:Rattus norvegicus


Alignment Length:173 Identity:63/173 - (36%)
Similarity:88/173 - (50%) Gaps:49/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            ||||:|||:.::|:|:::|||||||||::|||||.|..|.:.||.:..||.|||:..||:.||::
  Rat   110 KDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQF 174

  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEP- 131
            |:|  |:...|:|         ..|||                  |..|        |:.|..| 
  Rat   175 GDD--KNQAARHG---------HSHGD------------------FHRG--------FEADISPE 202

  Fly   132 DFFSSPFGGIGSRHGLGSGFRPSFRSHSF-NVHTPFKKEQKQD 173
            |.|:..|||         || ||...|.: |....:..:|:||
  Rat   203 DLFNMFFGG---------GF-PSSNVHVYSNGRMRYTYQQRQD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 63/173 (36%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 174..338 CDD:199909 63/173 (36%)
Dnajb12NP_001013929.1 DnaJ 111..172 CDD:278647 33/60 (55%)
DUF1977 269..369 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.