DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb9

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_038788.2 Gene:Dnajb9 / 27362 MGIID:1351618 Length:222 Species:Mus musculus


Alignment Length:223 Identity:78/223 - (34%)
Similarity:100/223 - (44%) Gaps:54/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            |.||.|||:||:|::.:||||:.|||::|||||||:.:||.||:|:|||||.|||.:.|:.||..
Mouse    25 KSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANSRKEYDTI 89

  Fly    68 GEDGLKSG-GTR-NGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTE 130
            |.....:| |.| ||.|...||.:.|..    .|..|        :||....|...||.|    |
Mouse    90 GHSAFTNGKGQRGNGSPFEQSFNFNFDD----LFKDF--------NFFGQNQNTRSKKHF----E 138

  Fly   131 PDFFSSPFGGIGSRH-----GLGSG-----FRPSFRSHSF------NVHTPFKKEQKQDPPVEHD 179
            ..|.:...|....||     ..|.|     |....:..||      |.||               
Mouse   139 NHFHTRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDTTNRHT--------------- 188

  Fly   180 LYVTLEEIYHGCVKKMKISRRIVQADGS 207
              |..|..:||   ..|..|.:.|..|:
Mouse   189 --VQTENRFHG---SSKHCRTVTQRRGN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 78/223 (35%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 174..338 CDD:199909 8/34 (24%)
Dnajb9NP_038788.2 DnaJ 26..87 CDD:278647 36/60 (60%)
Divergent targeting domain. /evidence=ECO:0000305 91..222 38/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.