DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJC16

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_056106.1 Gene:DNAJC16 / 23341 HGNCID:29157 Length:782 Species:Homo sapiens


Alignment Length:364 Identity:93/364 - (25%)
Similarity:146/364 - (40%) Gaps:104/364 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYG 68
            |.|::||:.:||:..:|||||:|||..:||||||...|||||.::::|||:||::.||..||:||
Human    29 DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDKFIQISKAYEILSNEEKRSNYDQYG 93

  Fly    69 EDGLKSGGTRNGGPSSNSFTYQFHGDPRA-TFAQFFGNSNPFASFF------DMGDNLFDKKVFD 126
            :.|...|             ||.....|. .|..|..|.....|||      :..|::.:|.:..
Human    94 DAGENQG-------------YQKQQQQREYRFRHFHENFYFDESFFHFPFNSERRDSIDEKYLLH 145

  Fly   127 L-----DTEPDFFSSPF------------------------------GGIGSRHGLGSGFRPSFR 156
            .     :..||.|..|:                              .|||..|   :|:.... 
Human   146 FSHYVNEVVPDSFKKPYLIKITSDWCFSCIHIEPVWKEVIQELEELGVGIGVVH---AGYERRL- 206

  Fly   157 SHSFNVH-TPF-------KKEQKQDPPVEHDLYVTLEEIYHG-CVKKMKISRRIVQADGSSRKEE 212
            :|....| ||.       |.....:..|..:|...:|.:..| .|:|:           :::...
Human   207 AHHLGAHSTPSILGIINGKISFFHNAVVRENLRQFVESLLPGNLVEKV-----------TNKNYV 260

  Fly   213 KFLAISIKPGWKSGTK---VTFQKEGDQAP-----GKIPADIVFIIRDKPHAMFKREGSDLRYTA 269
            :||:     ||:...|   :.|    ||.|     .|:.|   |..:|  :..|......||.|.
Human   261 RFLS-----GWQQENKPHVLLF----DQTPIVPLLYKLTA---FAYKD--YLSFGYVYVGLRGTE 311

  Fly   270 RLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKR 308
            .:|.:.   .:....||:...|..|:...::|:...:|:
Human   312 EMTRRY---NINIYAPTLLVFKEHINRPADVIQARGMKK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 93/364 (26%)
DnaJ 4..65 CDD:278647 32/60 (53%)
DnaJ_C 174..338 CDD:199909 30/144 (21%)
DNAJC16NP_056106.1 DnaJ 29..>142 CDD:333066 48/125 (38%)
TRX_DnaJ 136..245 CDD:239261 19/112 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.