DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJC18

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:280 Identity:76/280 - (27%)
Similarity:110/280 - (39%) Gaps:81/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            ::||:|||:.:.|:|:|:|||||||||::|||||.|..|.|.||.:..|:.|||:..||..||:|
Human    81 RNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEY 145

  Fly    68 GEDGLKSGGTRNGGPSSNSFTY--QFHGD--PRATFAQFFGNSNPFASFFDMGDNLFDKKVFD-- 126
            |::.:..     ..|.:..:.|  .|..|  |...|..|||...|..: ..|..|:.|...:.  
Human   146 GDEQVTF-----TAPRARPYNYYRDFEADITPEELFNVFFGGHFPTGN-IHMFSNVTDDTYYYRR 204

  Fly   127 -------------------------------------------LDTEPD---FFSSPFGGIGSRH 145
                                                       |.|.|.   |:.|..|...|| 
Human   205 RHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISR- 268

  Fly   146 GLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVE----HDLYVTLEEIY-----HGCVKKMKISRRI 201
                        .:.|:..|:..::..|....    |||..|:|:.|     ..|.|:.:....:
Human   269 ------------ETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSEL 321

  Fly   202 VQADGSSRKEE-KFLAISIK 220
            ....|..|.|. |..|.|:|
Human   322 TNLAGLYRDERLKQKAESLK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 76/280 (27%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 174..338 CDD:199909 15/57 (26%)
DNAJC18NP_689899.1 DnaJ 82..143 CDD:278647 33/60 (55%)
DUF1977 250..350 CDD:286411 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.