DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb3

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_032325.2 Gene:Dnajb3 / 15504 MGIID:1306822 Length:242 Species:Mus musculus


Alignment Length:231 Identity:87/231 - (37%)
Similarity:115/231 - (49%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            |||::||:|:.|:.:.|:||||||||::|||||  ....||.:||:||:|||||||..||||||:
Mouse     3 DYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERRFKQVAQAYEVLSDVRKREVYDR 67

  Fly    67 YGEDGLKSGGTRNGGPSSNSFTYQF-HGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTE 130
            .||.|...||...|.|..::|.|.| ..||...|.:|||..:||:..|..||.|           
Mouse    68 CGEVGEVGGGGAAGSPFHDAFQYVFSFRDPAEVFREFFGGHDPFSFDFFGGDPL----------- 121

  Fly   131 PDFFSSPFGGIGSRH--------------GLGSGFR------PSFRSHSFNVHTPFKKEQKQDPP 175
            .:||.......|||.              |.|.||.      .||.|...:..:.|.........
Mouse   122 ENFFGDRRSTRGSRSRGAVPFSTSFTEFPGFGGGFASLDTGFTSFGSPGNSGLSSFSMSCGGGAA 186

  Fly   176 VEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSRKE 211
            ..:....|..||.:|  ||: .::|||: :|..|.|
Mouse   187 GNYKSVSTSTEIING--KKI-TTKRIVE-NGQERVE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 87/231 (38%)
DnaJ 4..65 CDD:278647 38/62 (61%)
DnaJ_C 174..338 CDD:199909 12/38 (32%)
Dnajb3NP_032325.2 DnaJ 3..66 CDD:278647 38/62 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844331
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.