DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJB7

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_660157.1 Gene:DNAJB7 / 150353 HGNCID:24986 Length:309 Species:Homo sapiens


Alignment Length:340 Identity:94/340 - (27%)
Similarity:147/340 - (43%) Gaps:75/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            |||::|||.:.|:.::|||||.|:||::|||||  ....||.|||||||||||||:..||::|||
Human     3 DYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDK 67

  Fly    67 YGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEP 131
            ||.:||..||:.........||  || .|...|.:.|...:||:..|      |:..:.||...|
Human    68 YGTEGLNGGGSHFDDECEYGFT--FH-KPDDVFKEIFHERDPFSFHF------FEDSLEDLLNRP 123

  Fly   132 ------------------------DFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQ 172
                                    :.|||...|..|:..||.....||.|.:|:           
Human   124 GSSYGNRNRDAGYFFSTASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFD----------- 177

  Fly   173 DPPVEHDLYVTL-EEIYHGCVKKMKISRRIVQADGSSRKEEK-----FLAISI--KPGWKSGTKV 229
            :..:::.:.||. ::|.:|   :...:::|:::|.....|:.     ||..|:  :.|:......
Human   178 NSGMDNYISVTTSDKIVNG---RNINTKKIIESDQEREAEDNGELTFFLVNSVANEEGFAKECSW 239

  Fly   230 TFQKEGDQAP----GKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGD 290
            ..|...:.:|    .|..:...|:..|:....:.....|              ..:|......|.
Human   240 RTQSFNNYSPNSHSSKHVSQYTFVDNDEGGISWVTSNRD--------------PPIFSAGVKEGG 290

  Fly   291 KLRISTMQEIIKPNT 305
            |.:....:|:.|.:|
Human   291 KRKKKKRKEVQKKST 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 94/340 (28%)
DnaJ 4..65 CDD:278647 37/62 (60%)
DnaJ_C 174..338 CDD:199909 23/144 (16%)
DNAJB7NP_660157.1 DnaJ 2..>101 CDD:223560 52/100 (52%)
DnaJ 3..66 CDD:278647 37/62 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..309 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.