DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJC21

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_011512267.2 Gene:DNAJC21 / 134218 HGNCID:27030 Length:676 Species:Homo sapiens


Alignment Length:151 Identity:53/151 - (35%)
Similarity:83/151 - (54%) Gaps:28/151 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            |.:|:.||:.:.|:::|:|||||||||::|||||  .||.|.::||.:..||:||||..:|..||
Human    89 KCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYD 153

  Fly    66 KYGEDGLKSGGTRNGGPSSNS------FT---YQFHGDPRATFAQFFGNSNPFASFFDM-----G 116
            .:.|..||.|  .:|....:|      ||   |..:||....|...:.|      .|:|     .
Human   154 NHREALLKGG--FDGEYQDDSLDLLRYFTVTCYSGYGDDEKGFYTVYRN------VFEMIAKEEL 210

  Fly   117 DNLFDKKVFDL----DTEPDF 133
            :::.:::|.|.    |::.|:
Human   211 ESVLEEEVDDFPTFGDSQSDY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 53/151 (35%)
DnaJ 4..65 CDD:278647 31/62 (50%)
DnaJ_C 174..338 CDD:199909
DNAJC21XP_011512267.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.