powered by:
Protein Alignment CG5001 and Dnajc5
DIOPT Version :9
Sequence 1: | NP_001245832.1 |
Gene: | CG5001 / 33308 |
FlyBaseID: | FBgn0031322 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001258513.1 |
Gene: | Dnajc5 / 13002 |
MGIID: | 892995 |
Length: | 198 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 42/72 - (58%) |
Similarity: | 53/72 - (73%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKN-KAANAEDKFKEVAEAYEVLSDKSKREVYD 65
|:..|.:|||.|.||.|:|||:||||||:|||||| ....|.|||||:..|:.:|:|.:||.:||
Mouse 13 GESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYD 77
Fly 66 KYGEDGL 72
|||..||
Mouse 78 KYGSLGL 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5001 | NP_001245832.1 |
DnaJ |
1..347 |
CDD:223560 |
42/72 (58%) |
DnaJ |
4..65 |
CDD:278647 |
34/61 (56%) |
DnaJ_C |
174..338 |
CDD:199909 |
|
Dnajc5 | NP_001258513.1 |
DnaJ |
15..>84 |
CDD:223560 |
39/68 (57%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.