DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJB6

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_005249572.1 Gene:DNAJB6 / 10049 HGNCID:14888 Length:334 Species:Homo sapiens


Alignment Length:316 Identity:100/316 - (31%)
Similarity:139/316 - (43%) Gaps:86/316 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            |||::||:.:.|:.::||||||||||::|||||  ....||.|||:||||||||||..||::|||
Human     3 DYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67

  Fly    67 YGEDGLKSGGTRNGG-----PSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFD 126
            ||::||..||  .||     |....||::   :|...|.:|||..:||:  ||..::.|:     
Human    68 YGKEGLNGGG--GGGSHFDSPFEFGFTFR---NPDDVFREFFGGRDPFS--FDFFEDPFE----- 120

  Fly   127 LDTEPDFFSSPFGGIGSR-HGLGSGFR-----PSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLE 185
                 |||.:..|..||| .|.||.|.     |||.|...:..|.|               .:..
Human   121 -----DFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGF---------------TSFG 165

  Fly   186 EIYHG--------------------------CVKKMKISRRIVQADGSSRKEE------KFLAIS 218
            .:.||                          .|...||:.:.:..:|..|.|.      |.|.|:
Human   166 SLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTIN 230

  Fly   219 --------IKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLR 266
                    .:...:.|......:.....|.|.|.. ..::|..||.:.:.||...|
Human   231 GVADDDALAEERMRRGQNALPAQPAGLRPPKPPRP-ASLLRHAPHCLSEEEGEQDR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 100/316 (32%)
DnaJ 4..65 CDD:278647 38/62 (61%)
DnaJ_C 174..338 CDD:199909 21/133 (16%)
DNAJB6XP_005249572.1 DnaJ 2..>106 CDD:223560 56/107 (52%)
DnaJ 3..66 CDD:278647 38/62 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.