DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CHKov2

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:415 Identity:81/415 - (19%)
Similarity:175/415 - (42%) Gaps:73/415 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TQQQQLDYIERHLVYDI-------FK---NFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIA 57
            |.|....::.:.|...:       ||   .|.|::::       |.| :.:::.:..:.:::.:.
  Fly     2 TDQPTPQWVTKELFSSLLEQSNRNFKAIIKFVPTSAI-------SKG-ENYLTIVLRIQIEMQLK 58

  Fly    58 ERKRTEV-VLVKFMKGTEEFRESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCC 121
            :....:| .::|.....|:  |.::.:..|..|:..|..::|..|::...:   :.:...:.|. 
  Fly    59 DNSIEDVSYILKIPLVPED--EKNDFHEMFDAELDMYDHLIPELEDLYAKN---TSISPKFKPV- 117

  Fly   122 YFARFGHVEGLGNG-RESVLALKHLKGDGYQLGPRLT-LRRDQLEAMVGLVGPFHALGYATKILQ 184
                  |::..|.. :...:.|:.|:..||:...|.. |.:.::||::..:..:||.. |.::::
  Fly   118 ------HLKFPGEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAAS-AKRVVE 175

  Fly   185 PNVHARLRAGVVDMPFVSSSGKGI--FDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLR 247
            ...:.:   .:.:..|.:...|.:  |::.:.:.|....:.|:.:..||:..:|           
  Fly   176 LGEYEK---DIRESYFTTEHQKLLDEFNINFCMPFLECMQQYNLEPGQLVLISD----------- 226

  Fly   248 EKYFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFS 312
              |..|.|.|     ...|.::.| ...:...|||:..||.:|.|....:|:.:..:|||..::.
  Fly   227 --YTSQLTDL-----NIEFGKNDP-LELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYG 283

  Fly   313 TTAIDLSFFMYMNTPSEGRK-EIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFE 376
            |.|.|| ..:.|.:|....| :.:...:..||:.::|.|.: |..|||..|            ..
  Fly   284 TPAQDL-LCILMTSPKFSIKLDKFDYFIEYYHQQLVEHLTM-LNYNRNAPT------------LS 334

  Fly   377 RFNAHFKRYAFYGPMVCMHFLPWLL 401
            :|:||..||:.:..:.....||.:|
  Fly   335 KFHAHLHRYSLWAFICAQRMLPIVL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 59/317 (19%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 61/323 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.