DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG10562

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:449 Identity:90/449 - (20%)
Similarity:176/449 - (39%) Gaps:82/449 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYIERHLVYDIFK-NFGPSASLESHSVECSNGL-DGFMSALYTVTLDVVIAERKRTEV-VLVKFM 70
            |::...:..|:.| |....:.:::...:..:.. :.:.:.:..|.::|.:.:.|...| .:||..
  Fly     8 DWVTAEIFEDLLKANVDGYSKIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSKSVSYMVKLP 72

  Fly    71 KGTEEFRESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEV-VKNWVPCCYFARFGHVEGLGN 134
            ...|..:|.......|..|...|.|::|..|.:.:...::... .||:             .|.|
  Fly    73 HQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVDITFGAKNY-------------DLKN 124

  Fly   135 GRESVLALKHLKGDGYQLGPRLT-LRRDQLEAMVGLVGPFH---ALGYATKILQPNVHARLRAGV 195
            .:...:||:.|...|::...||. |.::..|.::..:..:|   |:..|||...|.:   |..|.
  Fly   125 AKTDYVALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGPYPKI---LLQGF 186

  Fly   196 V---DMPFVSSSGKGI-FDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTL 256
            .   ..|.:|...||: .:.:...|....:|.| ..|.:.||      ..||:::.|        
  Fly   187 FKEESRPVMSEMIKGMGANFVKSCATYEGHEAY-LDKVKALQ------PVAIDKIFE-------- 236

  Fly   257 LLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFF 321
                     ||:.:| :.|....|||...||::|.|.|..|:..:..:|:|..::.|.|.||.:|
  Fly   237 ---------FAKVEP-TEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYF 291

  Fly   322 MYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYA 386
            :..:|..|.:...:...::.||.:::|.|::        |...:....|::.....|     :|.
  Fly   292 LLSSTKLEDKLAKFDYYIKIYHDNLVEHLKI--------LKYSKPIPSLRDIHLALF-----KYG 343

  Fly   387 FYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDEANQEIFKTVRH 445
            ::|..|....:..:|....|.|.|...                |.|.:...:::.:.|:
  Fly   344 YFGYTVATGVMSAVLLDPTDSASLENF----------------IGGSDFQMQLYNSPRY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 73/321 (23%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 74/332 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.