DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG10560

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:443 Identity:91/443 - (20%)
Similarity:162/443 - (36%) Gaps:121/443 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKR-TEVVLVKFMKGTEEFRE 78
            |:.|..|::..:.:|.:.:...:.  :.:.:.:..:.|||...::.. |:..::|....|:.:|:
  Fly    29 LLKDNVKDYKKTKALRAKAGVAAG--ENYATIMLRLELDVETKDKSEVTKAFMLKTPHDTDAYRK 91

  Fly    79 SSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALK 143
            .......|..|...|..::|..|.:.|...||             .:||.........|:.:.|:
  Fly    92 LLQETNIFDVERGMYLVVVPELEQMYRDVGLE-------------VKFGAEAYEIKVSENYVLLE 143

  Fly   144 HLKGDGYQLGPRLT-LRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKG 207
            .|:..|::...||. |.:...|:::.....:||..               |..||:       ||
  Fly   144 DLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAAS---------------AVRVDL-------KG 186

  Fly   208 IFDVLYRVAFDRFYE----FYDRQKEQLLQGAD--PGFGAAIERLR---EKYF------KQPTLL 257
            .::..|...|.:..|    |.||..:.||...|  .|..|.|:.|:   ||.|      |:|   
  Fly   187 PYEEKYTNGFFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEP--- 248

  Fly   258 LERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFM 322
                         ....|....|||...||::|.|..::::.....:|.|..::.:.|.||.:|:
  Fly   249 -------------KSDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFL 300

  Fly   323 YMNTPSEGRKEIYADLLRKYHRSMIEMLELV--------LRRNRNEL------------------ 361
            ..:|..:.:.|.:...:..||..:::.|:|:        ||..||.|                  
  Fly   301 LSSTSLDIKTEKFDYFVWFYHSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVV 365

  Fly   362 ----TDDR-VDQLLQE---------YSFERFNAHFKRYAFYGPMVCMHFLPWL 400
                |||. .|:::..         |:..|:..|.|           ..||||
  Fly   366 LLDPTDDADFDKIISNEHSNFTNSIYTNPRYRRHMK-----------VVLPWL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 69/328 (21%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 70/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.