DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG10559

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:434 Identity:88/434 - (20%)
Similarity:160/434 - (36%) Gaps:116/434 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMKGT----EEFR 77
            |...|:|.|.|.|:..        :.:.:.:..:.|:|.:.:.   .:..|.:|..|    |.:|
  Fly    31 YAGIKSFKPEAGLKPG--------ENYSTIMLRLKLEVELQDH---TIENVSYMLKTPYDFEMYR 84

  Fly    78 ESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLAL 142
            |.......|:.|...:.:::|..|.:.:...:|             .:||           ..|.
  Fly    85 EILRKNNMFAVERDVFIQVIPELEQMYKDVGVE-------------VKFG-----------AKAY 125

  Fly   143 KHLKGDGY----QLGPRLTLRRDQLEAM--------VGLVGPFHALGYATKI----------LQP 185
            :....|.|    .|||......|:||.:        :..:..:||:. ||:|          |||
  Fly   126 EIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVS-ATRIHLKGPYPQNYLQP 189

  Fly   186 NVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKY 250
            .....::..:..:  ..:.||.....|      ..||.|:.            :.||:.:::.| 
  Fly   190 TYADTMKESIEQV--AETLGKYFLKCL------PLYEGYEE------------YSAAVHKMQPK- 233

  Fly   251 FKQPTLLLERIRTSSFAEDQPD-SHFATFLHGDYNRNNVLFHYGAEDKVDAIKA--IDFQELRFS 312
                      |....:|.:.|| ..|....|||...:|::|.| .::..:.|:.  :|.|..:.:
  Fly   234 ----------IVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKY-EDESPEPIETYFVDLQLPKVT 287

  Fly   313 TTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRV----DQLLQEY 373
            :.|.||.:|:..:|..|.:...:...::.||..::|.|.::   |..|.....:    .|||:  
  Fly   288 SVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRML---NYPEAKTPTLGFLHTQLLK-- 347

  Fly   374 SFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETD 417
             :.|...|.   ||   ::|.   |.||...:|......:.|||
  Fly   348 -YGRVGYHI---AF---ILCP---PVLLDRTEDANLTDFVTETD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 65/340 (19%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 65/355 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.