DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG31370

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:436 Identity:89/436 - (20%)
Similarity:165/436 - (37%) Gaps:112/436 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYIERHLVYDIFKNFGPSASLESHSVECSNGL---DGFMSALYTVTLDVVIAERKRTEVVLVKFM 70
            :::....|.|:.::......|....::.:.|.   |.:.|.:....::.:..:...::.:::|.:
  Fly    14 EWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKTV 78

  Fly    71 KGTEEFRESSNSYIQFSNEIFAYAEILPAYENVLR----TSHLESEVVKNWVPCCYFARFGHVEG 131
              .|.|..|:    .|..||..|.::||.:..:||    ||.|.:|       |.|::    :| 
  Fly    79 --LEMFAGSA----LFKTEIGMYRKVLPEFARILRENNDTSRLYAE-------CIYYS----LE- 125

  Fly   132 LGNGRESVLALKHLKGDGYQLGPRLTLRRDQLEAMVGLVGPFHALGYATKIL--QPNVHARLRAG 194
                ...|:..:.|....|.:.....|...::......:..||||  :.||:  :|......:.|
  Fly   126 ----PSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHAL--SMKIINERPEFVKEFKDG 184

  Fly   195 V--VDMPFVSSSGKGIF-DVLYRV-AFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPT 255
            :  ||:|:: |||.|.| |.|.|: ..||:...:::.:...           |:|||:       
  Fly   185 ICLVDIPYM-SSGMGPFKDFLGRIPELDRYKTHFEKIEVHF-----------IDRLRD------- 230

  Fly   256 LLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHY-----GAEDKVDAIKAIDFQELRFSTTA 315
             :::..:|:      |...:....||||:..|::..:     |.||    ...:|:|....:..|
  Fly   231 -IMKEYQTN------PQPGYYVLCHGDYHTRNIMVKHNKESGGFED----CMLLDYQGCYVAPLA 284

  Fly   316 IDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLE----------------------------- 351
            .||.:.:||....|.|......||..|...:.|.|.                             
  Fly   285 FDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFL 349

  Fly   352 ---------LVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAFY 388
                     |.|....||.|||::...::|  .:...|.|:|..::
  Fly   350 STYLPMSVGLSLETATNEETDDKLQDFIEE--CKSILARFERSGYF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 74/364 (20%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 74/330 (22%)
APH <202..320 CDD:279908 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.