DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG13659

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:449 Identity:90/449 - (20%)
Similarity:180/449 - (40%) Gaps:89/449 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFM---KGTEE--FRESSN 81
            :|.|:::...|          :.|.::...::........|:.:::|.|   :|.::  |::|. 
  Fly    41 SFTPASAKGDH----------YASIMFRARVEYTAQNGNFTKSLIIKTMIVEEGIKKDMFKDSP- 94

  Fly    82 SYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLK 146
               .|:.||..|.::||.:|.:||.:   ::..|.:|.|.|.:...|         .:|....|.
  Fly    95 ---LFTTEIGMYTKVLPEWERILRRA---NDPAKLYVECIYHSLQPH---------QILIFDDLV 144

  Fly   147 GDGYQLGPRLTLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDV 211
            ..||.:.....|.|:::.:....:...||:.......||......:.|:.:||       |:.| 
  Fly   145 EMGYAVVRDRFLTREEISSAYSKLAKIHAISMKFIHEQPEYLKEFKNGLCEMP-------GLID- 201

  Fly   212 LYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLRE--KY---FKQPTL-LLERIR-TSSFAED 269
                             ..::.|....|...:.|:.|  ||   ||:.:| ..:|:| |.....:
  Fly   202 -----------------SSIISGGMDPFMEMLGRIPELSKYQPHFKKISLHFKDRLRETMQEYRN 249

  Fly   270 QPDSHFATFLHGDYNRNNVLFHYGAEDK-VDAIKAIDFQELRFSTTAIDLSFFMYM-NTPSEGRK 332
            .|...:....|.|::..|::|....|.. .:....:|:|....:..|:||.:.:|| ..|::.|:
  Fly   250 NPQPGYNVLCHADFHSRNMMFKNNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMGPAQRRE 314

  Fly   333 EIYADLLRKYHRS-MIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHF 396
            |:  |:|..|:.| ::|.|:.:  ..:..:..:           :.|.|..||:.:|..::...|
  Fly   315 EL--DILLNYYLSILLETLKKI--GYQGSMPTE-----------QGFWAEMKRHRYYEFLLLSTF 364

  Fly   397 LPWLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDEANQEIFKTVRHAYE-HGYMDE 454
            ||..:|......::..:...:......:||       |...|..|::...:: .||.|:
  Fly   365 LPVSIGLRTHKLDIGDMMHNEETRKKLYQL-------EDFMEETKSILDRFQKSGYFDD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 70/326 (21%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 71/342 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.