DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG31097

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:436 Identity:95/436 - (21%)
Similarity:170/436 - (38%) Gaps:108/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FMSALYTVTLDVVIAE--RKRTEVVLVKFMKGTEEFRESSNSYIQFSNEIFAYAEILPAYENVLR 105
            |.|.:..|.||:|:.:  :||...| ||.|..:::..::.|....|..|...|:..||.:|.:.|
  Fly    50 FASVMLRVYLDIVMKDGSQKRKSYV-VKTMLESDKGGKAVNEMRYFHKEQQMYSTYLPQFEKIYR 113

  Fly   106 TSHLESEVVKNWVPCCYFARFGHVEG--------------LGNGRESVLALKHLKGDGYQLGPRL 156
            .:....::    :|.|  ...|.::|              :...|...:.::|:         ||
  Fly   114 VAGHPVQL----MPKC--LEIGEIDGNIYFIFEDLSTRNFVAADRTKGVNMEHM---------RL 163

  Fly   157 TLRR-DQLEAMVGL----VGPFHA---LGYATKILQPNVHARLRAGVVDMPFVSSSGK--GIFDV 211
            :||: .:|.|...:    .||:||   .|:|.|   ..:...:|...|..|...::.|  || |.
  Fly   164 SLRKLAELHAASVIYKERYGPYHADFDNGFARK---DKIEHSVRRFEVKAPEYKAAMKTWGI-DE 224

  Fly   212 LYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTLLLERIRTSSFAEDQPDSHFA 276
            .|...|.                           ..|:|.|   |.||.:..     |..|  |.
  Fly   225 CYLKNFP---------------------------TTEQYGK---LCLESLNV-----DPQD--FN 252

  Fly   277 TFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRK 341
            ...|||::.:|:||.|...........:|||..::::...||...:.::...:...:.:.:::|.
  Fly   253 VLTHGDFSPSNILFKYNENGAPSEALILDFQICKWASPTQDLLMLIILSARKDSSYKEFDNIVRI 317

  Fly   342 YHRSMIEMLELVLRRNRNELTDDRVDQL--LQEYSFERFNAHFKRYAFYGPMVCMHFLPW-LLGT 403
            |...:|:.|. ||:..:      .:.||  ||...:::.|..   .||:   ..|:.||. ||..
  Fly   318 YWEYLIDFLR-VLKYKK------PLPQLRELQSAIYKKNNTF---SAFF---AVMNHLPGDLLPV 369

  Fly   404 EKDC--------AELSRLFETDMH-GPAFHQLSLDIAGDEANQEIF 440
            .|:.        .|:.:.|.|.:: .|.|.::..::.....|:.:|
  Fly   370 CKENNLHTFNLEDEVGKSFRTKVYTNPIFVEVVKELYPICCNRGLF 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 73/335 (22%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 75/338 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.