DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG31104

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:458 Identity:88/458 - (19%)
Similarity:182/458 - (39%) Gaps:67/458 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YIERHLVYDIFKNFGPSASLESHSVECSNGL---DGFMSALYTVTLDVVIAERKRTEVVLVKFMK 71
            ::....:.||.:.:.....|:...::.|...   |.:.|.::...::....:.|..:.:::|.|.
  Fly    18 WLNAQFIGDILREYEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFFKPLIIKTMP 82

  Fly    72 GTEEFRES--SNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGN 134
            ..|..::.  |.|:: |..||..|...||.:|.:||.:   .:..|.:|||.|.:.         
  Fly    83 EQEGHKKDMLSESHL-FETEIGMYCHALPEFERILREA---GDNTKLFVPCIYHSL--------- 134

  Fly   135 GRESVLALKHLKGDGYQLGPRLTLRRD------QLEAMVGLVGPFHALGYATKILQPNVHARLRA 193
            ....|:..:.|...||      |:.||      .|:.....:..:||:.......||......:.
  Fly   135 KPRQVMIFEDLVPQGY------TVIRDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQY 193

  Fly   194 GVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTLLL 258
            |:.:||.:.:      |.........|.|..|:..|  |:.....|    |::::.|.::    |
  Fly   194 GLFEMPTIDT------DPFITTGMTNFIEMLDKMPE--LRKYKHHF----EKIKDNYMQR----L 242

  Fly   259 ERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAE-DKVDAIKAIDFQELRFSTTAIDLSFFM 322
            | :....:.:.:.:..:....|||::..|::|.:..| ...|.:..:|||........:||::.:
  Fly   243 E-VEMHEYHKYRRNDRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSV 306

  Fly   323 YMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAF 387
            ||....|.|.|:..:|:.:|...::..|..:..:.         |...|...:|:...: |.|.|
  Fly   307 YMLMEPEQRWEMGENLINEYFSVLVATLRKIGYKG---------DMPTQRELWEQIQNN-KYYDF 361

  Fly   388 YGPMVCMHFLPWLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDEANQEIFKTVRHAYEHGYM 452
            :   :...|||.::|.:.:..::....:........:.|      |:..|:::|.:....:.||.
  Fly   362 F---LISTFLPIMVGVKSNDLKMHEALQDSQARLKSYFL------DDYVQDVYKLLTKYEQLGYF 417

  Fly   453 DEI 455
            .::
  Fly   418 KDL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 68/320 (21%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 68/324 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.