DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG10513

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:390 Identity:90/390 - (23%)
Similarity:141/390 - (36%) Gaps:85/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 AERKRTEVVLVKFMKGTEEFRESSNSYIQFS-NEIFAYAEILPAYENVLRTSHLESEVVKNWVPC 120
            |:...||..:||.....:.|.....|..|.| .|:..|.:|||         .|.|.:.|...|.
  Fly    70 AKSPETEYYIVKTTYENDAFASGIFSQYQVSTTEMRMYEKILP---------QLSSLIEKTRQPE 125

  Fly   121 CYFARFGHVEGLGNGRESVL-----ALKHLKGD---GYQL-GPRLTLRRDQLEAMVGLVGPFHAL 176
            ..||:..||:   ...|:::     ..|::..|   |:.| ..||.||:         :...||.
  Fly   126 KVFAKTLHVD---YEHEAIIFEDLAVTKYVLADRLVGFDLEHTRLGLRK---------LAKMHAA 178

  Fly   177 GYATKILQPNVHARLRAGVVDMP-------FVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQG 234
            .......||.:..:...|:.:..       ||::.|         ||.|                
  Fly   179 AAVLNERQPGLLTKFDHGIFNRHTQAFAPFFVNTVG---------VAAD---------------- 218

  Fly   235 ADPGFGAAIERLREKYFKQPTLLLERI-RTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKV 298
                |......|.|:|..:...|.||: ..|:...|.....|.|.:||||..|||:..||...:.
  Fly   219 ----FARECPELGERYATKLKKLQERVMEYSTRVYDPQPGDFNTLVHGDYWVNNVMLRYGENKEP 279

  Fly   299 DAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTD 363
            ..:..||||...:|:.|:||.:|...:...:.|.|....|.:.||..::|.|:            
  Fly   280 LDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYHTVLVETLK------------ 332

  Fly   364 DRVDQLLQEY--SFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHGPAFHQL 426
               |.....|  :..:|....:|..|:...|.:.....|...:...|:.:.|.:.|..|..|.::
  Fly   333 ---DLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNADADFNALMKDDERGRNFRKV 394

  Fly   427  426
              Fly   395  394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 78/313 (25%)
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 79/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.