DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG6834

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:422 Identity:81/422 - (19%)
Similarity:154/422 - (36%) Gaps:127/422 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DGFMSALYTVTLDVVIAER--KRTEVVLVKFMKGTEEFRESSNSYIQFSNEIFAYAEILPAYENV 103
            |.|.|.|..:.::..:.:.  |....:|....|.|.:.....|   .|..|:..|.:.:||:|.:
  Fly   531 DNFASKLLKIDIETQLKDHTSKTFSYILKVQPKSTPDNFTDVN---MFPKEMEMYQKYVPAFEQL 592

  Fly   104 LRTSHL------ESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGPRLT-LRRD 161
            .:.:.|      .|.|:...|                 :|..|.:::|:..|:::..|:. |..:
  Fly   593 YKDAGLTVTFTANSFVLNKAV-----------------KEEYLLMENLQTKGFKMADRMKGLNME 640

  Fly   162 QLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAF------DRF 220
            ..::.:..:..:||.....|.|                      .|.:..||....      |.|
  Fly   641 HTKSSLKKLAQWHAASIKYKEL----------------------NGAYPPLYNDGIYIEQTRDVF 683

  Fly   221 YEFYDRQKEQLL------QGADPGFGAAIERLREKYFKQPTLLLERIRTSSFAEDQPDSHFATFL 279
            :..:...||..:      :|||. :...:|.:.:.:..|   :||..:.:..|       |....
  Fly   684 HNMFASAKEAYIRIFGTFEGADE-YLPKLEWIIDNHVDQ---VLEDAKINEQA-------FNVLN 737

  Fly   280 HGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHR 344
            |||...||::|.|.||.::.....:|.|..::...|.||.:|:..:...:.:.:.:.:|:|.||.
  Fly   738 HGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRFYHE 802

  Fly   345 SMIEMLELVLRRN-----RNE-----------------------LTDDRVDQLL------QEYSF 375
            :::|..:| |:.|     .:|                       |||:..:..|      :..:|
  Fly   803 NLVEHTKL-LKYNGFVPSLSELHAILIEHPAFAVGTVISTLTVCLTDEGFNPELFFVETPESEAF 866

  Fly   376 -------ERFNAHFKRYAFYGPMVCMHFLPWL 400
                   ||:.||.::           .:|||
  Fly   867 RTKLLGNERYKAHVEK-----------IMPWL 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 65/332 (20%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 67/335 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.