DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG6830

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:482 Identity:96/482 - (19%)
Similarity:164/482 - (34%) Gaps:165/482 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QQQQLDYIERHLVYDIFKNFGPSAS------LESHSVECSNGLDGFMSALYTVTLDVVIAERK-R 61
            |.:..|.|...|..|.||....||.      |.|.|...:...|.|.|.|..|.::..:.:.. :
  Fly   475 QPENTDQIPDWLNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVK 539

  Fly    62 TEVVLVKFMKGTEEFRESSNSYIQFSN------EIFAYAEILPAYENVL-----------RTSHL 109
            |...::|.        .|.|..|.||:      ||..|:..:||:|...           ::..|
  Fly   540 TFSYILKV--------HSDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRL 596

  Fly   110 ESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGPRLTLRRDQLEAMVGL----- 169
            ..:|.|.:                      |.|::|:..|:::          ::.|:|:     
  Fly   597 SKDVSKEY----------------------LLLENLQPSGFKM----------VDRMIGMDLEHS 629

  Fly   170 ------VGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQK 228
                  :..:||             |.|:...::.|:......|||.......|...  |.:.:|
  Fly   630 KCTLKKLAQWHA-------------ASLKYKELNGPYSPKYNNGIFTEQTAPIFKGM--FVNTKK 679

  Fly   229 EQL-----LQGADPGFGAAIERLREKYFKQPTLL---LERIRTSSFAEDQPDSHFATFLHGDYNR 285
            ..:     ..|.|           |...|.|.:|   ::||...:...:|.   |....|||...
  Fly   680 SFIEEVSKFDGVD-----------EYLHKMPEILDTYVDRILEDAKINEQA---FNVLNHGDAWI 730

  Fly   286 NNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEML 350
            ||::|.|.::.:|.....:|.|..::...|.||.:|:..:|..:.:.:.:..|:|.||::|.|..
  Fly   731 NNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHA 795

  Fly   351 ELV------------------------------LRRNRNELTDD-RVDQLLQE-----------Y 373
            :|:                              |....|:.||| ..|..|..           :
  Fly   796 KLLNYNGFIPSLKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMF 860

  Fly   374 SFERFNAHFKRYAFYGPMVCMHFLPWL 400
            |.||:.|:.:|           .:||:
  Fly   861 SNERYRANIER-----------VMPWI 876

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 69/348 (20%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 70/352 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.