DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG5644

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:444 Identity:105/444 - (23%)
Similarity:177/444 - (39%) Gaps:72/444 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VECSNGL---DGFMSALYTVTLDVV----IAERKRTEV--VLVKFMKGTEEFRESSNSYIQFSNE 89
            :.||.|.   |.:||.:..||:...    ..|...:|:  |:||....:...|:.......||||
  Fly    56 IACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEAFSNE 120

  Fly    90 IFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGP 154
            |.||..:.|     |..:|...::    .|.|:.|. ........|.|.::.|:.||..|:::..
  Fly   121 INAYRHLAP-----LLAAHSRHQL----FPVCHIAE-SQDRRDAEGGEPIIVLQDLKAMGFRMKD 175

  Fly   155 RLT-LRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAF- 217
            ||. |.......::..:...||...|.:.|:                 |||.....|.|..:.: 
  Fly   176 RLAGLELSDCLLVMKKLAQLHAASLAAQELE-----------------SSSFAFHADHLQEIVYC 223

  Fly   218 DRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTLLLERIRTSSF---------AEDQPDS 273
            |...:||....:..:|.|....|.|   ..:.....|..|||.:||:.|         ....|:|
  Fly   224 DEATDFYATILDTSVQQALESLGDA---NADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNS 285

  Fly   274 HFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYAD- 337
               ...|||...||::|....|:.:    ..|.|.:|.|:...|:..|:|.:| ....::::.| 
  Fly   286 ---VICHGDLWVNNIMFRSEPEEVI----FFDLQAMRKSSPIFDILHFIYTST-RRPLRDVHTDT 342

  Fly   338 LLRKYHRSMIEMLELVLRRNRNELTD----DRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLP 398
            ||..|.:::.|.|       |::|.|    :|:::|.:.:|.:|.::.:.|...||..:.|..||
  Fly   343 LLAAYSQALSEEL-------RHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILP 400

  Fly   399 WLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDEANQEIFKTVRHAYEHGYM 452
            .:.....:...|..:.|.::.|....  ...:...|.:..|.:.|...||.||:
  Fly   401 AVTFDPNNLPNLDVMSEQNLTGKEIK--CTQMLTSEYHMRIRELVMEFYELGYL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 79/329 (24%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 79/336 (24%)
P-loop_NTPase <357..435 CDD:304359 15/79 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.