DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG9259

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:344 Identity:81/344 - (23%)
Similarity:136/344 - (39%) Gaps:78/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PSASLESHSVECSNGLDGFMSALYT-VTLDVVIAERKRTEVVLVKFMKGTEEFRESSNSYIQ--- 85
            |:..|.||              ||. |||.:..:|..|.   |..|.|......||...|::   
  Fly    45 PAGYLGSH--------------LYLHVTLKLHNSEEVRQ---LTFFSKSAPVGNESRMEYLEDFG 92

  Fly    86 -FSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDG 149
             |..||..|..:||......      :||    .|.||:|           .:::|..::|...|
  Fly    93 VFEKEIAVYQNVLPDLHKAC------AEV----APKCYYA-----------DKNLLIFENLADQG 136

  Fly   150 YQLGPRL--TLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVL 212
            |::|...  .|..:||...:..:...|    |..|:|..     |.|   .....|..|.:.:..
  Fly   137 YRMGAGRDGLLTYEQLHCCLKTLAAMH----AGSIIQEQ-----RTG---QKIAQSQPKSVVENA 189

  Fly   213 YRVAFD----RFYEFYD-----RQKEQLLQGADPGFGAAIERLREKYFKQPTLLLERIRTSSFAE 268
            |.....    |...|.:     ::..:|:    |.:.:.::.:.|.:.::.:.:.|.::||    
  Fly   190 YPSDVSPEHMRMVNFQNACLVLKEFIKLI----PKYQSKLDYVLENFTEKMSFIFEAVKTS---- 246

  Fly   269 DQPDSHFATFLHGDYNRNNVLFHYGAEDKVD-AIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRK 332
               |.:..|.||||...||::|.||...:|. ..:.:|||..|::...:|:...:.:.|..|.|.
  Fly   247 ---DVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRD 308

  Fly   333 EIYADLLRKYHRSMIEMLE 351
            ...::||.:|:|.|.|.|:
  Fly   309 AHLSELLAEYYRFMTEFLK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 77/328 (23%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 75/318 (24%)
APH <252..325 CDD:279908 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.