DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG33509

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:406 Identity:89/406 - (21%)
Similarity:146/406 - (35%) Gaps:122/406 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDYIERHLVYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERK--RTEVVLVKFM 70
            |||   |||.|:      ||.             |::...|.:||.....|.:  |...:.||.|
  Fly    24 LDY---HLVRDL------SAI-------------GYLGDYYALTLRYCHEEEEIIREIELFVKAM 66

  Fly    71 KGTEEFRESSNSYIQFSNEIFAYAEI---LPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGL 132
              .::..|.|...| |..|.:.|..:   |.|..||            .|.|.|.::        
  Fly    67 --PQQSAELSKESI-FQKESWLYDTLIKKLQALSNV------------KWSPNCVYS-------- 108

  Fly   133 GNGRESVLALKHLKGDGYQLGPRLTLRRDQLEAMVGLVGPFHALG--------------YATKIL 183
               |:.::.|:::|..|:.......|....::.::..:..||:..              |...:|
  Fly   109 ---RKDLMVLENIKLKGFTSAGSAELNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLL 170

  Fly   184 QPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLRE 248
            :..|.:.          ::....|:..||   |..|....|...:||...| |...|        
  Fly   171 EITVDSE----------IAWFTTGLSAVL---AVVRSLAKYQGNREQSFIG-DKLMG-------- 213

  Fly   249 KYFKQPTLLLERIRTSSFAEDQPDSHFATFL-HGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFS 312
                    ::|.|    :.:..|...:...| |.|....|:.|  ..|:...|: .||||..|::
  Fly   214 --------IMETI----YEQAAPSKKYRNVLCHRDIWAGNIFF--PPENSGPAL-LIDFQTCRYA 263

  Fly   313 TTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEML------ELVLRRNRNELTDDRVDQLLQ 371
            ..|.||:|.:|||..|..||::....:..||..:::.|      |||:.::          :||:
  Fly   264 PPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKS----------ELLE 318

  Fly   372 EY-SFERFNAHFKRYA 386
            .| .|..|...::..|
  Fly   319 SYEEFRLFGVVYRAVA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 72/337 (21%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 65/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.