DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG33510

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:433 Identity:88/433 - (20%)
Similarity:153/433 - (35%) Gaps:111/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GFMSALYTVTLDVVIAERK--RTEVVLVK---FMKGTEEFRESSNSYIQFSNEIFAYAEILPAYE 101
            ||:...:.:.....:.::|  :|..:.||   |.....||                |.|.:...|
  Fly    54 GFLGEYFHLYFQYQLEDQKDVQTSRLFVKSVIFQNANMEF----------------YMEKMGLIE 102

  Fly   102 NVLRTSHLESEVVK----NWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGPRLT--LRR 160
            ..::...|.:|:.|    .|...|||.           |:.:..:::::..||...|..|  |..
  Fly   103 KEIKLYDLLNELKKFSKHVWSAKCYFT-----------RKDLFVMQNVEDMGYVALPPGTRFLNE 156

  Fly   161 DQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYR-----VAFDRF 220
            :|:..::..:...||...|                    :....||.| .|.:|     |:.|..
  Fly   157 NQMGPILKSLATLHASSIA--------------------YEKQQGKTI-GVEFRKWLKEVSVDPE 200

  Fly   221 YEFYDRQKEQLLQGADPGFGAAIERLR---------EKYFKQPTLLLERIRTSSFAEDQPDS-HF 275
            .|:|......:|         |:..:.         ::|..|.   |.|.....:....|.. |.
  Fly   201 VEWYTTGLRAVL---------AVAAIHPDVLDNPEAQEYIAQE---LPRCLDKVYCMVNPSPVHR 253

  Fly   276 ATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLR 340
            ..|:|.|....||.:|.....:..:| .:|||..|:|..|:|.....|:|.....||::...|:.
  Fly   254 NVFVHRDAWNANVFYHKEKPHEERSI-LVDFQLCRYSPPAMDFHLVTYLNLEPFSRKKMIGSLIE 317

  Fly   341 KYHRSMI-EMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLPWLLGTE 404
            .|:.::. |..|:.:...:.:|:....:|.|.::|.  |.|.:...|.....:..::|..|    
  Fly   318 TYYDALAEEFREMGVNPYQEQLSKQEFEQSLNDFSL--FGATYNCIAATVLRLPDNYLKNL---- 376

  Fly   405 KD---------C-----AELSRLFETDMHGPAFHQLSLDIAGD 433
            ||         |     |::.||.:   :.|.|.....|..||
  Fly   377 KDERPEDFHRFCNVDRSADVLRLMK---NHPEFADYMYDCVGD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 68/337 (20%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 47/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.