DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG7135

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:467 Identity:102/467 - (21%)
Similarity:180/467 - (38%) Gaps:96/467 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQLDYIERHLVYDIFKNFGPSASLESHSVECSN---GLDGFMSALYTVTLDVVIAERKRTEVVLV 67
            ||||                   |:...|:.:|   |.:.:.|.:|...:....||....|..|:
  Fly    26 QQLD-------------------LQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLI 71

  Fly    68 KFMKGTEEFRESSNSYIQ-FSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEG 131
              :|...:.:::..:.:. ::.|...|..|.|..| .|....::|.......|..|::.      
  Fly    72 --VKSMPDEKQAILARLHIYNKETLFYMHIKPKLE-ALMWRAVDSFSAWTLAPKHYYST------ 127

  Fly   132 LGNGRESVLALKHLKGDGYQLGPR-LTLRRDQLEAMVGLVGPFHALGYATKILQP-NVHARLRAG 194
              ...|..:.|:.|...||||..| |.|..|....::..:..:|||.......:| .:..|...|
  Fly   128 --TQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFG 190

  Fly   195 VVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQ-----GADPGFGAAIERLREKYFKQP 254
            ::.|..::|..   |.:|:..              |||:     |...|||....:| .:|.:..
  Fly   191 LLHMDAINSEP---FKLLFGT--------------QLLKLAALVGDCEGFGGITTKL-YRYHEHF 237

  Fly   255 TLLLERIRTSSFAEDQP-DSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDL 318
            |   ||:..:.:    | ..:.....|||...||:.|.|.||..|..:|.||||...:.:...|:
  Fly   238 T---ERVLKAVY----PLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDI 295

  Fly   319 SFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFK 383
            ::|:..:...|..::...:|:..|:||:::.|:.:.........:|.:|::.            |
  Fly   296 NYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIR------------K 348

  Fly   384 RYAFYGPMVCMHFLPW--LLGTEKDCAELSRLFETDMHGPAF--HQLSLDIAGDEANQEIFK-TV 443
            |.| ||..|...|.|.  ::|.:.:...|.     :.|...|  .::.|...|:....|..| |:
  Fly   349 REA-YGFFVAFGFFPLMSMIGVDSEDNSLK-----NFHDETFARQKVQLMFEGNTRTLESLKCTL 407

  Fly   444 RHAYEHGYMDEI 455
            :.      :||:
  Fly   408 KR------LDEL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 73/320 (23%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 74/322 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.