DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG31300

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:354 Identity:81/354 - (22%)
Similarity:156/354 - (44%) Gaps:44/354 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YIERHLVYDIFKNFGPSASLESHSVE---CSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMK 71
            ::.|..:.:|...:..|..|:...::   .|...|.:.|.::..|.:...|:.|.:..:::|.|.
  Fly    20 WLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSRPLIIKAMP 84

  Fly    72 GTEEFRES--SNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGN 134
            ..:..::.  |.|:: |..||..|.::||.:|.:||.|   .:..|.:|||.|.:    :|    
  Fly    85 EQDGHKKDMLSESHL-FETEIGMYCQVLPEFERILRES---GDDTKLFVPCIYHS----LE---- 137

  Fly   135 GRESVLALKHLKGDGYQLGPRLTLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMP 199
             ...|:..:.|...||.:.....:.:::|:.....:..:||:.......||:.....:.|:.:||
  Fly   138 -PRKVMIFEDLVPQGYYVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMP 201

  Fly   200 FVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTLLLERIRTS 264
            .|.:      |.........|.|..||..|  |:...|.|    |::::||.::...:::     
  Fly   202 TVKT------DPFITTGMQSFIEMLDRLPE--LRKYKPHF----EKIKDKYMQRLQAVMK----- 249

  Fly   265 SFAEDQPDSHFATFLHGDYNRNNVLFH----YGA-EDKVDAIKAIDFQELRFSTTAIDLSFFMYM 324
            .:.|::....|....|||::..|::|.    .|| ||.:    .:|||........|||::.:||
  Fly   250 EYHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTM----LVDFQISNLCPITIDLTYSIYM 310

  Fly   325 NTPSEGRKEIYADLLRKYHRSMIEMLELV 353
            ....|.|:|:..||:..|...::..|:.:
  Fly   311 LMEPEQRREMGKDLINHYLTVLVATLKSI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 76/318 (24%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 76/322 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.