DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG1561

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:476 Identity:104/476 - (21%)
Similarity:186/476 - (39%) Gaps:95/476 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QQLDYIERHLVYDIFKNFG--PSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVK 68
            :|:....|.||..::...|  |...||..|.:.    |.::..::.:.   ..::.||:  ::||
  Fly   226 EQVTQFLRQLVSQLWPELGANPELRLERASAKG----DNYLGVVWRLQ---AASDSKRS--LVVK 281

  Fly    69 FMKGTEEFRESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWV----------PCCYF 123
            ........|:...:...|..|..||...||          |.:.:...|.          ..|:.
  Fly   282 LPPQNRVRRKQFFARPCFLRETAAYEVFLP----------LTALIQDKWKIIGDDRFRQHALCFG 336

  Fly   124 ARFGHVEGLGNGRESVLALKHLKGDGYQLGPR-LTLRRDQLEAMVGLVGPFHALGYATKILQPNV 187
            .|       .:.....:.|:.|...|:.|..| |.|..:.:..::......||:..|.|...|..
  Fly   337 TR-------QDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEK 394

  Fly   188 HARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQ----LLQGADPGFGAAIER--L 246
            ..:|:. :||          ||:  .|........:::..||.    ||..||..:...:|.  .
  Fly   395 MQQLQQ-LVD----------IFE--QRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFA 446

  Fly   247 REKYFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRF 311
            |..||:   |||..:  |.| ..:|   ||...|||...||:|:......:::.::.||:|.:|:
  Fly   447 RGSYFE---LLLPLV--SGF-NCEP---FAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRY 502

  Fly   312 STTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSM-IEMLELVLRRNRNELTDDRVDQLLQEYSF 375
            ::...||::|::..|....|:....::|..|:..: ::::.|          .:||:||....:|
  Fly   503 ASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQLIRL----------GERVEQLFPRPAF 557

  Fly   376 ERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFE-------TDMHGPAFHQLSLDIAGD 433
            :.   .....|..|.::.|..||.:....:|..:|..:.|       ||:||..|..     ||:
  Fly   558 DE---QVATKAAVGLLLAMMVLPIVTMQGQDVPDLQAISERIEAGATTDLHGAGFLG-----AGN 614

  Fly   434 EA--NQEIFKTVRHAYEHGYM 452
            ||  .|.|.:.:....:..|:
  Fly   615 EATFKQRIREVILDCVDFNYI 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 69/329 (21%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 70/346 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.