DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG31975

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:285 Identity:70/285 - (24%)
Similarity:115/285 - (40%) Gaps:65/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 FARF-GHVEGLGNG-----RESVLALKHLKGDGYQLGPRLTLRRDQLEAMVGL--VGPFHALGYA 179
            |.|| |..|.|.:.     :.:||.|::|:..||..|.||. ..|....::.|  :..||||..|
  Fly   116 FPRFYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLK-AFDLAHTLLALKYMAEFHALSLA 179

  Fly   180 TKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRF------YEFYDRQKEQLLQ----- 233
            .:||:|.|                     |....|..|.:|      .|:....|.:.|:     
  Fly   180 LRILRPEV---------------------FREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRA 223

  Fly   234 -GADPGFGAAIERLREKYFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDK 297
             ..|....|.::.|.:::|:          ..:.|.|:||..|.:.:|.|:..||::|.||....
  Fly   224 TNNDSRLVARMKELSDQFFE----------FLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGT 278

  Fly   298 VDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELT 362
            ...:|.||||..::.:...|:..|:..:..:...:..:..:|..|:    |..|..||       
  Fly   279 PVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYY----EAFERCLR------- 332

  Fly   363 DDRVDQLLQEYSFERFNAHFKRYAF 387
              ||...|:.::|:.|....||.|:
  Fly   333 --RVGAKLEVHTFKEFRLEVKRVAY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 60/249 (24%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 63/263 (24%)
APH <214..329 CDD:279908 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.