DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG31436

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:455 Identity:95/455 - (20%)
Similarity:172/455 - (37%) Gaps:105/455 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMKGTEEFRES- 79
            |.|:  .|.|:::...|          :.|.::...:.....:.:..:.:::|.|...|..::. 
  Fly    41 VIDL--TFSPASAKGDH----------YASIMFRARVKYTNRKGEFQKSLIIKTMPEAEGHKKDM 93

  Fly    80 -SNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALK 143
             ..|.| |..|:..|.::||.:|.:||....::::   :|.|.|.:...|         .||..:
  Fly    94 LGGSPI-FETEMGLYTKVLPEFERILRQVGDDTQL---YVNCIYHSLEPH---------QVLIFE 145

  Fly   144 HLKGDGYQLGPRLTLR-----RDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSS 203
            .|...||     :.||     .|::..:...:..:||:....:..||........|:.:||.|  
  Fly   146 DLAEMGY-----IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEMPHV-- 203

  Fly   204 SGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAA----IERLREKYFKQPTLLLERIRTS 264
                :.|...|...:.|.|...::.|  |....|.|.:.    :|||.|::        :.||.|
  Fly   204 ----LNDPFMRTGMEFFVELLGKEPE--LNKYKPYFESIKDDFLERLVEEW--------KDIRKS 254

  Fly   265 SFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSE 329
                 |....:....|||.:..|::|.:.....::....:|||.........||.:.:||....|
  Fly   255 -----QKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPE 314

  Fly   330 GRKEIYADLLRKYHRSMIEMLELVLRR--NRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMV 392
            .|...:.||:..|    |.:|:.||::  .:..:..       |...::|.:.| |.|.|:   :
  Fly   315 HRWNNWDDLINYY----ISVLQDVLKKIGYKGVMPS-------QSGLWKRLHQH-KYYEFF---L 364

  Fly   393 CMHFLP--WLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDEANQEIFKTVRHAYEHGYMDEI 455
            ...|||  |                      |....|:|......|:|  |..:.::..||:.|:
  Fly   365 ISTFLPLMW----------------------ALRDKSVDFGDLLQNEE--KRRKCSFSKGYIKEV 405

  Fly   456  455
              Fly   406  405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 69/322 (21%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 72/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.