DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG31380

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:429 Identity:80/429 - (18%)
Similarity:146/429 - (34%) Gaps:131/429 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HLVYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMKGTEEFRE 78
            ||||        |:.:|.|.:.             ...|:...||.|..:.              
  Fly    48 HLVY--------SSIVEEHLIA-------------KTVLEYEDAETKMKKA-------------- 77

  Fly    79 SSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALK 143
               .|..::.|:..|.::||..:. |....|..:::             |::    .:...|.::
  Fly    78 ---PYDIYNRELEIYEQVLPKLQE-LAGEQLCPKIL-------------HID----RQRGALIME 121

  Fly   144 HLKGDGYQLGPRLTLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPF-VSSSGKG 207
            .|...|:.:.|||....:|..::|  :.....:..|:.:|:.|        :::..| ::...||
  Fly   122 DLSYKGFVMAPRLQRLDEQHVSLV--LRKLAKMQAASAVLENN--------LLENNFSLTEYDKG 176

  Fly   208 IFDVLYRVAFDRF-----------------YEFYDRQKEQLLQGADP---GFGAAIERLREKYFK 252
            .|: .|..:|..:                 ||.:    .:||....|   |.|.       :.||
  Fly   177 FFN-RYTESFSAYFLGCLKSCANYLKTQAGYEHH----AKLLDELAPYYMGLGL-------RCFK 229

  Fly   253 QPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAID 317
                             |..:|.....|||...||::|.|.|....|.: .||||...:.:..:|
  Fly   230 -----------------QEQTHINVLTHGDLWTNNMMFKYEAGVPSDVL-LIDFQYAFWGSPTLD 276

  Fly   318 LSFFMYMNTPSEGRKEIYADLLRKYHRSMI-EMLELVLRRNRNELTDDRVDQLLQEYSFERFNAH 381
            :...:..:...:.|.|:...:...||...: |:..|..:..|..             |.::|:..
  Fly   277 IHHLLNTSAVEQVRSELQMKMRGVYHDVFVGELQRLGFKGQRLP-------------SRKQFHLE 328

  Fly   382 FKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHG 420
            .::..||.....:..||.||.|::..|:.:.|......|
  Fly   329 SEQKRFYAVHCGLLLLPVLLNTDETDADFAALLSDQPRG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 59/333 (18%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 67/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.