DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG2004

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:461 Identity:118/461 - (25%)
Similarity:188/461 - (40%) Gaps:87/461 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RHLVYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTL-DVVIAE----RKRTEV-VLVKFMK 71
            ||..|    .||||.         ..| |.::|.::.:|: .|..||    .|:.|: |:||.|.
  Fly    30 RHTSY----KFGPSG---------KKG-DAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMP 80

  Fly    72 GTEEFRESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWV--PCCYFARFGHVEGLGN 134
            .....|....|.|.|.|||..|.::|||.|...::.  :....|.:|  |.|       :..|.:
  Fly    81 DNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSR--QPAPKKPFVEYPRC-------LASLCD 136

  Fly   135 GRESVLALKHLKGDGYQLGPRLTLRRDQL---EAMVGL--VGPFHALGYATKILQPNVHARLRAG 194
            |....:||:.:...||    |..:|:|.:   :|::.:  :|.||.:..|...|. :.:....||
  Fly   137 GVNDFIALEDVGPRGY----RAPVRQDYISLEDALLTMRTLGRFHGVALAFNALD-SKNFEKAAG 196

  Fly   195 VVDMPFVSSSGK----GIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPT 255
            .::..:.....:    |...:...||.|...:.|...|.:.:               ...|.||.
  Fly   197 SLEETYYGEHTREWYTGFLLLAENVATDAVKQIYPNSKYETV---------------ATNFLQPP 246

  Fly   256 LLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSF 320
            |..:.|...|     ..|..:.|.|||....|.|..|....:.:.|..||||..|.|:.|:||||
  Fly   247 LFDDLINLVS-----TRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSF 306

  Fly   321 FMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRY 385
            |:|..|..|.|::.|.:|||.|..|..:::: .|..|...:           .|:|......|.:
  Fly   307 FIYSCTSQELREQHYDELLRAYLESAQDLIQ-DLGGNAESI-----------ISWESLQEELKNF 359

  Fly   386 AFYGPMVCMHFLPWLLGTEKDCAELSRLFE----TDMHGPAFHQLSLDIAGDEANQEIFKTVRHA 446
            ..:|..:.:..||..:..:.:.|:|..:.|    ||:......:.|   |..:...:|||   ||
  Fly   360 GRFGCGMGIESLPMTMMEDDEVADLDGIKENAILTDIWNITPFKES---AKQQRLADIFK---HA 418

  Fly   447 YEHGYM 452
            .:.||:
  Fly   419 IDQGYI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 88/328 (27%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 89/333 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.