DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG32195

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:487 Identity:110/487 - (22%)
Similarity:166/487 - (34%) Gaps:142/487 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTQQQQLDYIERHL--VYDI----FKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAER 59
            |..:....:|.||.|  .|..    .:||        |....|...:.|.|.:|.|.|       
  Fly     1 MEREIYSAEYFERALARAYGCEMLRVENF--------HIKAVSQKGENFCSVIYRVAL------- 50

  Fly    60 KRTEVVLVKFMKGTEEFRES------SNSYI----------QFSNEIFAYAEILPAYENVLRTSH 108
                           .||.|      |..||          ..:||...:..:|||.:.:|..:.
  Fly    51 ---------------VFRRSPDGALESGKYILKDLLPAAAALGTNEKDMFEVLLPAMQAILEEAP 100

  Fly   109 LESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQ-LGPRLTLRRDQLEAMVGLVGP 172
            .|....|....|..      || :..|:| :..|:.|...||: ...|..|..::.:..|..:..
  Fly   101 KEIGEHKLSADCLL------VE-ISAGKE-LYILEDLGALGYESFDRRQGLNLEEAKICVRKLAQ 157

  Fly   173 FHALGYATKIL---QPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQG 234
            ||.   |:|:|   :|.:..||      .|...::|..          |||      .:..:|:|
  Fly   158 FHG---ASKVLYEKKPELIQRL------SPSHYANGLN----------DRF------AQALVLEG 197

  Fly   235 ADPGFGAAIERLRE--KYFKQ--PTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAE 295
            |:....|..|.|.|  |..|.  |....:|:|.   ..|...|.....:|||...||::|.:..:
  Fly   198 AEYAAEAFAEELPEISKKMKAQIPKAYTKRMRD---VVDPNKSSLNAVIHGDPWLNNIMFDFVNK 259

  Fly   296 DKVDAIKA--IDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNR 358
                  ||  :|||...:.:.||||.|..|.:...|                       :|..|:
  Fly   260 ------KATLVDFQNCYWGSPAIDLYFLFYTSLKPE-----------------------LLLNNQ 295

  Fly   359 NELTDDRVDQLLQEY----------SFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAE--LS 411
            :||.:...|.||:..          :|.:.....||..|||....:..||....:.:...:  :.
  Fly   296 DELLNYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCASPEASVDFGVH 360

  Fly   412 RLFETDMHGPAFHQLSLDIAGDEANQEIFKTV 443
            ...:||......|||   .|.:...|.|..|:
  Fly   361 TFVDTDAMLKKRHQL---FASERVRQTIKATL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 76/337 (23%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 83/364 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.