DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5126 and CG33301

DIOPT Version :9

Sequence 1:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:405 Identity:88/405 - (21%)
Similarity:154/405 - (38%) Gaps:99/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GFMSALY---------TVTLDVVIAERKRTEVVLVKFMKGTEEFRESSNSYIQFSNEIFAYAEIL 97
            |.|:.:|         .|....::.:....||      ...|.|.|    |..::.|:..|..||
  Fly    43 GVMTRIYVDYQLGDGSVVNKTYIVKQALSAEV------PQAEVFFE----YELYTREMDMYEFIL 97

  Fly    98 PAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRE-SVLALKHLKGDGYQLGPRLTLRRD 161
            |..:.:|:.:.|:.::.              .:.:...|| :.:.|:       .|.|...:..|
  Fly    98 PKLKELLQEAGLDQKLT--------------ADAITVDREYNTMILE-------DLAPYKFVNAD 141

  Fly   162 QL--------EAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFD 218
            ::        |..:.::..|||   |:.:||.. |..|........|.|...|. :.|::...|.
  Fly   142 RVKQLDMAHTELTLEMLAKFHA---ASIVLQER-HPNLLTKCFYTHFFSRDKKA-YSVVFAGLFK 201

  Fly   219 RFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTLLLERIRT-----SSFAEDQPDSHFATF 278
            .|..|.|.|                ..|:|.|..:    |.::||     .:.|.|..:|...|.
  Fly   202 AFLRFIDGQ----------------PNLKEAYGDK----LHKLRTHIMEYGARAYDVGESDLKTL 246

  Fly   279 LHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSE-GRKEIYADLLRKY 342
            .|||....|::|.|....:..::.|||||....::..|||.:|...:...| |.||  ::|:..:
  Fly   247 NHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE--SELVEHH 309

  Fly   343 HRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLPWLL--GTEK 405
            :::        |:.|..:.:.......||||..:     |:|..|...:..| |.|.::  |:| 
  Fly   310 YKA--------LKANLEKFSYKGSLPTLQEYRLQ-----FERRRFMSLLAHM-FKPCMIYNGSE- 359

  Fly   406 DCAELSRLFETDMHG 420
            :.::.|.|:.....|
  Fly   360 ETSDFSSLYAESPEG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 71/334 (21%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 73/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.