DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4896 and STIPL1

DIOPT Version :10

Sequence 1:NP_608583.5 Gene:CG4896 / 33305 FlyBaseID:FBgn0031319 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_173150.1 Gene:STIPL1 / 838277 AraportID:AT1G17070 Length:849 Species:Arabidopsis thaliana


Alignment Length:233 Identity:58/233 - (24%)
Similarity:87/233 - (37%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 YG--GPSDSEDDNSANQKALEASVGTKRAISDESDYVDFQKLTCLLCMRAFQSLDILQKHLKMSN 804
            ||  ..|||:.|:|..    ..|...:|...|.....|..|....:..........:.|..:..|
plant    44 YGIFAESDSDSDDSGG----GGSRRKRRKDRDSGRKADLTKPVNFVSTGTVMPNQEIDKDSREHN 104

  Fly   805 LHKENLDKLKRNPAVEA----------------------GTDE---------GLSYRDRAKERRL 838
            ..|:. ||::.|..::.                      |.|:         |....||||.|  
plant   105 DEKDR-DKIEDNDMIDEDVEVRGGLGIGSSGLGLGFNANGFDDEDNLLPGALGKKIADRAKMR-- 166

  Fly   839 KYGESDPPPPNRSRERFEQEIKTLQSRQKDSFGATAAMPISST-NVGSRLMQKMGWSEGQGLGKK 902
              |::       ..|:..||....:..:|::.|:.......|| .:|.:|::|||: :|.||||.
plant   167 --GKA-------KVEKRGQEGGGAKGGKKNTLGSDIGQFEKSTKGIGMKLLEKMGY-KGGGLGKN 221

  Fly   903 NQGRTEIIEADGRSNNVGLGNNTGHMAPGNDYKSYIKK 940
            .||....|||..|..|:|:|.|....|...|.|...:|
plant   222 QQGIVAPIEAQLRPKNMGMGYNDFKEAKLPDLKKVEEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4896NP_608583.5 U2AF_lg 74..>158 CDD:273727
RRM1_RBM5_like 211..291 CDD:409977
ZnF_RBZ 296..320 CDD:197784
RanBP2-type Zn finger 298..317 CDD:275376
RRM1_RRM2_RBM5_like 343..429 CDD:409752
OCRE_RBM5_like 562..617 CDD:293881
OCRE repeat 1 567..574 CDD:293881
OCRE repeat 2 575..582 CDD:293881
OCRE repeat 3 583..590 CDD:293881
OCRE repeat 4 591..598 CDD:293881
OCRE repeat 5 600..607 CDD:293881
G-patch 882..924 CDD:396249 19/41 (46%)
STIPL1NP_173150.1 TIP_N 6..105 CDD:463593 13/64 (20%)
G-patch 200..243 CDD:396249 20/43 (47%)
GCFC 420..687 CDD:400273
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.