DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4896 and AT3G52350

DIOPT Version :10

Sequence 1:NP_608583.5 Gene:CG4896 / 33305 FlyBaseID:FBgn0031319 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_190803.1 Gene:AT3G52350 / 824400 AraportID:AT3G52350 Length:180 Species:Arabidopsis thaliana


Alignment Length:144 Identity:36/144 - (25%)
Similarity:64/144 - (44%) Gaps:19/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 KLKRNPAVEAGTDEGLSYRDRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKDSFGATAAM 876
            :|:.....:..||.|::.:....:||.|..:|     ..:...:.:::..:.....:|...:.| 
plant    18 QLRERQGWKESTDMGITKQGLVIQRRKKTEKS-----QATISHYSEKVSNVIGDSSESSNPSTA- 76

  Fly   877 PISSTNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLG------------NNTGHMA 929
             |||:|:|.:|::|.||.||.|||...||....::|:.:.|..|||            .:|....
plant    77 -ISSSNIGFQLLKKHGWKEGTGLGITEQGILVPLQAEPKHNKQGLGAEKPAKRKPAQPQDTAFEE 140

  Fly   930 PGNDYKSYIKKMMK 943
            .....|...||::|
plant   141 VSKKSKKLSKKLVK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4896NP_608583.5 U2AF_lg 74..>158 CDD:273727
RRM1_RBM5_like 211..291 CDD:409977
ZnF_RBZ 296..320 CDD:197784
RanBP2-type Zn finger 298..317 CDD:275376
RRM1_RRM2_RBM5_like 343..429 CDD:409752
OCRE_RBM5_like 562..617 CDD:293881
OCRE repeat 1 567..574 CDD:293881
OCRE repeat 2 575..582 CDD:293881
OCRE repeat 3 583..590 CDD:293881
OCRE repeat 4 591..598 CDD:293881
OCRE repeat 5 600..607 CDD:293881
G-patch 882..924 CDD:396249 18/53 (34%)
AT3G52350NP_190803.1 G-patch 79..123 CDD:396249 19/43 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.