DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4896 and pinx1

DIOPT Version :9

Sequence 1:	NP_608583.5	Gene:	CG4896 / 33305	FlyBaseID:	FBgn0031319	Length:	949	Species:	Drosophila melanogaster
Sequence 2:	NP_001013283.2	Gene:	pinx1 / 368253	ZFINID:	ZDB-GENE-030515-2	Length:	355	Species:	Danio rerio

Alignment Length:	83	Identity:	25/83 - (30%)
Similarity:	46/83 - (55%)	Gaps:	7/83 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   863 QSRQKDSFGA---TAAMPISSTNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNN 924
            :.|:|..:..   .:|.....:..|.:::::||||:|:||||..||.||.|:...::|::|||..
Zfish     6 EPRRKQKWSVDPRNSAWSNDESKFGQKMLERMGWSKGKGLGKTEQGSTEHIKVKVKNNSLGLGTA 70

  Fly   925 TGH----MAPGNDYKSYI 938
            ..|    :|..:|:...:
Zfish    71 VNHEDNWIAHQDDFNQLL 88

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4896	NP_608583.5	DUF1777	91..>158	CDD:285811
		RRM1_RBM5_like	211..291	CDD:241005
		ZnF_RBZ	296..320	CDD:197784
		RanBP2-type Zn finger	298..317	CDD:275376
		RRM1_RRM2_RBM5_like	343..429	CDD:240759
		OCRE_RBM5_like	562..617	CDD:293881
		OCRE repeat 1	567..574	CDD:293881
		OCRE repeat 2	575..582	CDD:293881
		OCRE repeat 3	583..590	CDD:293881
		OCRE repeat 4	591..598	CDD:293881
		OCRE repeat 5	600..607	CDD:293881
		G-patch	882..922	CDD:279867	17/39 (44%)
pinx1	NP_001013283.2	G_patch	24..70	CDD:197727	19/45 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D786674at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010