DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4887 and CG31550

DIOPT Version :9

Sequence 1:NP_001259859.1 Gene:CG4887 / 33304 FlyBaseID:FBgn0031318 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001262285.1 Gene:CG31550 / 40661 FlyBaseID:FBgn0051550 Length:835 Species:Drosophila melanogaster


Alignment Length:333 Identity:68/333 - (20%)
Similarity:129/333 - (38%) Gaps:83/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   689 LADAEQKGEEESKKAKEKEGGNKHDKVKVAKKIVKDMEKWAKQLNQKKDYTAVATPQPILANEVA 753
            |:|.|::..||:...:..:|.::.|         :|.::..:|..:::..:.....:..|.:...
  Fly   544 LSDEERREREEAASGEPPDGDDQDD---------QDDKESQRQRRKRERKSRWGEKEQQLPSSST 599

  Fly   754 TTSRGNQ-----GGYADVGFSILEKKERGKLNDYAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQ 813
            :.:.|||     .|......::|   :..:||                 ||.|..|||       
  Fly   600 SGNFGNQNKPILSGITRTDPALL---QYARLN-----------------YGSTQLSEE------- 637

  Fly   814 NTQSSAVVSGGGGAEESDYVDFHKLTCLLCKRAFQSLEILQKHLKMSTLHKENLAKLNQNTSSSI 878
                          :.....:.:|:..|     :|  ::::|..::..|.:....|...::...|
  Fly   638 --------------QWKQCEEHYKVNLL-----YQ--DMMRKRQEIDRLARGGKFKYEYDSDEDI 681

  Fly   879 E-------------EALAYRDRA--KERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKQSTSAT 928
            |             ||.:....|  |:...|:...|..||...: :|.::.:..::.::...|..
  Fly   682 EGGTWEHKLRTAEMEATSLWANALTKQSEGKHHIGDFLPPEELK-KFMEQYEAKKNNRQPDLSDY 745

  Fly   929 PAMPISSSNVGSRLLQKMGWSEGQGLGRKNQGRTQ-IIEADGRSNYVGLGNKSGQMIP---GNDY 989
            ....:...|:|.::|||:||.||||||:...|... :.:|..|....|||..|... |   .|:|
  Fly   746 KEYKLKEDNIGFQMLQKLGWKEGQGLGQDGAGIVDPVNKAPQRDGNQGLGVSSAAQ-PEDCDNEY 809

  Fly   990 KSYIKKMM 997
            .:|.|:||
  Fly   810 DAYRKRMM 817

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4887NP_001259859.1 DUF1777 115..>196 CDD:285811
RRM_SF 255..335 CDD:302621
ZnF_RBZ 341..364 CDD:197784
RanBP2-type Zn finger 342..361 CDD:275375
RRM1_RRM2_RBM5_like 387..473 CDD:240759
OCRE_RBM5_like 623..678 CDD:293881
OCRE repeat 1 628..635 CDD:293881
OCRE repeat 2 636..643 CDD:293881
OCRE repeat 3 644..651 CDD:293881
OCRE repeat 4 652..659 CDD:293881
OCRE repeat 5 661..668 CDD:293881
G-patch 935..979 CDD:279867 19/44 (43%)
CG31550NP_001262285.1 G-patch 753..797 CDD:279867 19/43 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D786674at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.