DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4887 and Gpatch2l

DIOPT Version :9

Sequence 1:NP_001259859.1 Gene:CG4887 / 33304 FlyBaseID:FBgn0031318 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001128031.1 Gene:Gpatch2l / 314325 RGDID:1308907 Length:474 Species:Rattus norvegicus


Alignment Length:230 Identity:46/230 - (20%)
Similarity:78/230 - (33%) Gaps:70/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   791 MNKLVNAYGGTSDSEE-----DNAASSQNTQSSAVVSGGGGAEESDYVDFHKLTCLLCKRAFQSL 850
            ::.|.:|...||:..:     :..|.|...|...:....|....||:....:..|...:.:..||
  Rat     5 VHDLASALEQTSEQSKLGELWEEMALSPRQQRRQLRKRRGRKRRSDFTHLAEHACCFSEASESSL 69

  Fly   851 EILQKHLKMSTLHKENLAKLNQNTSSSIEEALAYRDRA-----KERRLKYGESD------PPPPN 904
            :...|..:       .:|.|. |.|.|.:..:|.|..|     :.::..:.|||      |..|.
  Rat    70 DEATKDCR-------EVAPLT-NFSDSDDTVVAKRHPALSAIVRGKQHSWHESDSFTENAPCRPL 126

  Fly   905 RSRER-----------FEQEIKT----------LQSRQKQSTSATPAMPISSSNVGSRLLQKMGW 948
            |.|.:           .:|::|.          .:|.:||..              ||..:...|
  Rat   127 RRRRKVKRVASEVAASLQQKLKVSDWSYERGCRFKSAKKQRL--------------SRWKENTPW 177

  Fly   949 -SEGQGLGRKNQGRTQI----------IEADGRSN 972
             |.|.||....:.||.:          .||:|:.:
  Rat   178 TSSGHGLCESAESRTFLSKTGRKERMECEAEGQKH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4887NP_001259859.1 DUF1777 115..>196 CDD:285811
RRM_SF 255..335 CDD:302621
ZnF_RBZ 341..364 CDD:197784
RanBP2-type Zn finger 342..361 CDD:275375
RRM1_RRM2_RBM5_like 387..473 CDD:240759
OCRE_RBM5_like 623..678 CDD:293881
OCRE repeat 1 628..635 CDD:293881
OCRE repeat 2 636..643 CDD:293881
OCRE repeat 3 644..651 CDD:293881
OCRE repeat 4 652..659 CDD:293881
OCRE repeat 5 661..668 CDD:293881
G-patch 935..979 CDD:279867 12/49 (24%)
Gpatch2lNP_001128031.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.