DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4887 and sqs2

DIOPT Version :10

Sequence 1:NP_608582.2 Gene:CG4887 / 33304 FlyBaseID:FBgn0031318 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_588327.3 Gene:sqs2 / 2539327 PomBaseID:SPCC1442.13C Length:187 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:32/133 - (24%)
Similarity:58/133 - (43%) Gaps:28/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   849 SLEILQ--KHLKMST---LHKENLAKLNQNTSSSIEEALAYRDRAKERRLKYGESDPPPPNRSRE 908
            ||.:::  :|..:.|   |.|:..:||.:.|...::         |.:|::..|.          
pombe    77 SLSMIEYDRHFALQTDVKLSKKRKSKLVEMTPKGLK---------KRKRVQIQEG---------- 122

  Fly   909 RFEQEIKTLQSRQKQSTSATPAMPISSSNVGSRLLQKMGWSEGQGLGRKNQGRTQIIEADGRSNY 973
                .:.|...::........:.|..::..|.:||:.||||.|:|||.:|||....:.|..::|.
pombe   123 ----SVSTNTKKRMDGHVVGSSAPAINNGKGKQLLEMMGWSRGKGLGSENQGMVDPVVAVVKNNK 183

  Fly   974 VGL 976
            .||
pombe   184 QGL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4887NP_608582.2 U2AF_lg 93..>193 CDD:273727
RRM_SF 255..335 CDD:473069
ZnF_RBZ 341..364 CDD:197784
RanBP2-type Zn finger 342..361 CDD:275377
RRM1_RRM2_RBM5_like 387..473 CDD:409752
OCRE_RBM5_like 623..678 CDD:293881
OCRE repeat 1 628..635 CDD:293881
OCRE repeat 2 636..643 CDD:293881
OCRE repeat 3 644..651 CDD:293881
OCRE repeat 4 652..659 CDD:293881
OCRE repeat 5 661..668 CDD:293881
G-patch 935..979 CDD:396249 18/42 (43%)
sqs2NP_588327.3 G_patch 145..186 CDD:197727 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.