powered by:
Protein Alignment CG4887 and si:ch211-161c3.6
DIOPT Version :9
Sequence 1: | NP_001259859.1 |
Gene: | CG4887 / 33304 |
FlyBaseID: | FBgn0031318 |
Length: | 1004 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373672.1 |
Gene: | si:ch211-161c3.6 / 100334833 |
ZFINID: | ZDB-GENE-131126-51 |
Length: | 111 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 25/74 - (33%) |
Gaps: | 23/74 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 870 LNQNTSSSIEEALA-YRDRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKQSTSATPAMPI 933
:.::.:..:||..| .|.|.:.|:......:|..|.|.|.| |.
Zfish 3 MEESGAGQMEETAAPKRSRGRPRKAPQEPVEPSAPRRPRGR----------------------PR 45
Fly 934 SSSNVGSRL 942
.|.|.|.||
Zfish 46 GSKNKGQRL 54
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0154 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.