DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Charon and Asb7

DIOPT Version :10

Sequence 1:NP_608581.2 Gene:Charon / 33303 FlyBaseID:FBgn0031317 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_536691.2 Gene:Asb7 / 117589 MGIID:2152835 Length:318 Species:Mus musculus


Alignment Length:285 Identity:58/285 - (20%)
Similarity:97/285 - (34%) Gaps:86/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 RKSHIMSEEGLLPIHEEILHGDVYGVKRQI-------------FVCCHAKMDINELLTRDGEDCL 306
            |::..:.||  |.|...:..|||:.|::.:             :...|..      ..|..|.|:
Mouse     7 RRNPELQEE--LQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFS------AARGKERCV 63

  Fly   307 ELALTNDTD---------------------TEIVSLILDARMMTDHLYENSN---TALHLAVINH 347
            .:.|.:..|                     ..|..|:|::...:|.:...||   |.||:|.  |
Mouse    64 RVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAA--H 126

  Fly   348 INIES-IRLLLR-RIDLNSLLLTNDDGYTVLHLAVRNNQFLVVEAILDSIDERELGETVYRRTLE 410
            ...:| :||||. :.:::.|   :|.|.|.|.||:...:...|:.:||.                
Mouse   127 YGRDSFVRLLLEFKAEVDPL---SDKGTTPLQLAIIRERSSCVKILLDH---------------- 172

  Fly   411 AANPNEWDEKGFAKYYDRACERLELNKTLLKNRAHKRDVI------NASEARGGNPPLFYAVEGE 469
              |.|...:.||...|          ..:..|.::.|..:      |......|..||..:...:
Mouse   173 --NANIDIQNGFLLRY----------AVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRD 225

  Fly   470 QEHLCYFLLAHLADPDEENLSGHSP 494
            .......|..:.||.:..|..|.:|
Mouse   226 DVLCARMLYNYGADTNTRNYEGQTP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CharonNP_608581.2 ANKYR 290..513 CDD:440430 48/237 (20%)
ANK repeat 301..333 CDD:293786 8/52 (15%)
ANK repeat 335..369 CDD:293786 13/38 (34%)
ANK repeat 371..455 CDD:293786 16/89 (18%)
ANK repeat 457..488 CDD:293786 6/30 (20%)
Asb7NP_536691.2 ANK 1 13..42 8/30 (27%)
ANKYR 16..251 CDD:440430 55/274 (20%)
ANK repeat 46..77 CDD:293786 6/36 (17%)
ANK 2 46..75 6/34 (18%)
ANK 3 80..109 3/28 (11%)
ANK repeat 81..114 CDD:293786 4/32 (13%)
ANK repeat 116..147 CDD:293786 11/35 (31%)
ANK 4 116..145 10/30 (33%)
ANK repeat 149..180 CDD:293786 10/48 (21%)
ANK 5 149..178 10/46 (22%)
ANK 6 180..208 5/37 (14%)
ANK repeat 213..244 CDD:293786 6/30 (20%)
ANK 7 213..242 6/28 (21%)
SOCS_ASB7 273..317 CDD:239696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.