DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14341 and Mea1

DIOPT Version :9

Sequence 1:NP_608580.2 Gene:CG14341 / 33301 FlyBaseID:FBgn0031315 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001037751.1 Gene:Mea1 / 685131 RGDID:1597751 Length:174 Species:Rattus norvegicus


Alignment Length:180 Identity:40/180 - (22%)
Similarity:63/180 - (35%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PELPSDPGQEGLPTPPVDHPRGGVESEDDDDSDAYDG-------YQPLALDEENDAADPEEMSRE 61
            |....|.|....||    ...|...||:.::.....|       ||||       ..|||:    
  Rat    18 PNQTEDLGPHQGPT----EGTGDWSSEEPEEEQEETGAGPAGYSYQPL-------NQDPEQ---- 67

  Fly    62 QETPSADNDEDVDLMTAPVTHGDPNMPAIE-------------PADVEIERQVWSEPRPRELQMD 113
                     |:|:|  |||..|:.....|:             |.:.|.|.:..:........:.
  Rat    68 ---------EEVEL--APVGEGEDGAADIQDRIQALGLHLPDPPLESEDEDEEGAAALSSHSSIP 121

  Fly   114 LDKTRTEQILKAMSTITLPNITVPDWARGVPEEHWKHELLDRINNRHHPP 163
            :|....|.:.:.|:.::||...||.|||.:.:..|:..:...:..|...|
  Rat   122 MDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14341NP_608580.2 None
Mea1NP_001037751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83 23/90 (26%)
MEA1 54..170 CDD:399714 30/137 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..123 3/27 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1638941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR17005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.