DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14341 and mea1

DIOPT Version :9

Sequence 1:NP_608580.2 Gene:CG14341 / 33301 FlyBaseID:FBgn0031315 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_031757361.1 Gene:mea1 / 100144996 XenbaseID:XB-GENE-1010323 Length:181 Species:Xenopus tropicalis


Alignment Length:142 Identity:42/142 - (29%)
Similarity:63/142 - (44%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGVESEDDDDSDAYDGYQPLALDEENDAADPEEMSREQETPSADNDEDVDLMTAPVTHGDPNMPA 89
            ||.|.|:|.:..:...||||       ..||||.::.:    .|..|.:..|...:    |..||
 Frog    61 GGEEEEEDGEVQSGYQYQPL-------NQDPEEGTQTE----GDIQERLQAMRLHL----PEPPA 110

  Fly    90 IEPADVEIERQVWSEPRPRELQMDLDKTRTEQILKAMSTITLPNITVPDWARGVPEEHWKHELLD 154
            ....:.|.|....|.|        :|....|.:.|||:.:|||:::||.||..:.:..|:|.:..
 Frog   111 DSEDEEEREEAASSIP--------MDPAHVELVKKAMAGVTLPSLSVPLWAEQISDADWEHLVHQ 167

  Fly   155 RINNRHHPPEPS 166
            .|.:|...| ||
 Frog   168 TIQSRAAAP-PS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14341NP_608580.2 None
mea1XP_031757361.1 MEA1 74..175 CDD:399714 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1638941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.