DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango14 and cPT8

DIOPT Version :10

Sequence 1:NP_608577.2 Gene:Tango14 / 33298 FlyBaseID:FBgn0031312 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_200858.1 Gene:cPT8 / 836171 AraportID:AT5G60500 Length:271 Species:Arabidopsis thaliana


Alignment Length:30 Identity:9/30 - (30%)
Similarity:18/30 - (60%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VDAGVDAVLLS--RIFDFALDVGIKHVSLY 103
            :|||..|..:|  .|..:..::|:.:|:|:
plant    57 LDAGHRAGFISVKYILQYCKEIGVPYVTLH 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango14NP_608577.2 None
cPT8NP_200858.1 Cis_IPPS 38..259 CDD:259850 9/30 (30%)

Return to query results.
Submit another query.