DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango14 and Y32B12B.8

DIOPT Version :10

Sequence 1:NP_608577.2 Gene:Tango14 / 33298 FlyBaseID:FBgn0031312 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001256710.1 Gene:Y32B12B.8 / 13217484 WormBaseID:WBGene00202504 Length:114 Species:Caenorhabditis elegans


Alignment Length:41 Identity:12/41 - (29%)
Similarity:15/41 - (36%) Gaps:9/41 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 FARQTCTYGLLPW--------HARFTEFHTHPSGRHFDVET 261
            |.|..|.|..| |        ...|..::....||.:||.|
 Worm    68 FCRCLCVYRCL-WLFLIMLVCFLIFLYYNRDNIGRAWDVYT 107

Return to query results.
Submit another query.